PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_54929g0010
Common NameCOL1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family CO-like
Protein Properties Length: 444aa    MW: 49643.1 Da    PI: 4.9373
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_54929g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box25.92e-0881125341
       zf-B_box   3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvp 41 
                     ++C+ +e+ ++   C+ +   lC +C + +H+       H++ p
  MA_54929g0010  81 VWVCEVCEQAPAVVTCKADAAALCVSCDTDIHSAnplasrHERAP 125
                    689*****************************6678888888766 PP

2CCT68.51.8e-23377420144
            CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                    Rea++lRY+eKrk+R+FeK+irY+sRKa+Ae+RpR+KGrF+k++
  MA_54929g0010 377 REARVLRYREKRKNRRFEKTIRYASRKAYAETRPRIKGRFAKRT 420
                    9*****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003360.0953676IPR000315B-box-type zinc finger
CDDcd000211.40E-44083No hitNo description
PROSITE profilePS5011910.42479126IPR000315B-box-type zinc finger
SMARTSM003367.5E-1579126IPR000315B-box-type zinc finger
PfamPF006436.8E-780125IPR000315B-box-type zinc finger
CDDcd000211.39E-782126No hitNo description
PfamPF062032.1E-17377419IPR010402CCT domain
PROSITE profilePS5101716.797377419IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 444 aa     Download sequence    Send to blast
MVKEEDKDWH TVEDLHRGSH VDHKEFLRGI GGWRMSMPKL CDVCQVSNSV LYCRAHTAQL  60
CLVCDVKIHG GSKASLCHER VWVCEVCEQA PAVVTCKADA AALCVSCDTD IHSANPLASR  120
HERAPVIPFY ECPNMPNNNT ATNANNDNLD CNVLLNEDGG GDDPLKHDYV DDDYDDYDDD  180
ENDHNNLLNH QEEDNDAEIC CAEEAATASW LIPEANRNNL TNINGGNSEG EDKMVKDKLK  240
FKAYMQSIDF LQDVENYVDL EYLGTTTTIT TPTTPTAHMG ADSMVPVHTP EVIEHSSTKV  300
SVETARSLDV DAASKCNYVY RTTSLNHCVS SSSIDVGIVP DSNTTTDIST PYHDPRGVFE  360
IPPRVVHPGG HVEVMGREAR VLRYREKRKN RRFEKTIRYA SRKAYAETRP RIKGRFAKRT  420
EVEVEQIYSS SLLPDQGYGV VPSY
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1135470.0BT113547.1 Picea glauca clone GQ03412_N02 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLB3VTV20.0B3VTV2_PICAB; Constans-like protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6911767
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24790.18e-39CONSTANS-like 3
Publications ? help Back to Top
  1. Holefors A, et al.
    Identification of PaCOL1 and PaCOL2, two CONSTANS-like genes showing decreased transcript levels preceding short day induced growth cessation in Norway spruce.
    Plant Physiol. Biochem., 2009. 47(2): p. 105-15
    [PMID:19097801]